Iright
BRAND / VENDOR: Proteintech

Proteintech, 26054-1-AP, TSEN15 Polyclonal antibody

CATALOG NUMBER: 26054-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSEN15 (26054-1-AP) by Proteintech is a Polyclonal antibody targeting TSEN15 in WB, ELISA applications with reactivity to human samples 26054-1-AP targets TSEN15 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TSEN15 is the non-catalytic subunit of the tRNA-splicing endonuclease complex, which is a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini (PMID: 15109492, 27392077). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22082 Product name: Recombinant human TSEN15 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-171 aa of BC022030 Sequence: MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR Predict reactive species Full Name: tRNA splicing endonuclease 15 homolog (S. cerevisiae) Calculated Molecular Weight: 171 aa, 19 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC022030 Gene Symbol: TSEN15 Gene ID (NCBI): 116461 RRID: AB_3669520 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WW01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924