Proteintech, 26057-1-AP, C4orf7 Polyclonal antibody

Size: 20ul / 150ul The C4orf7 (26057-1-AP) by Proteintech is a Polyclonal antibody targeting C4orf7 in WB, ELISA applications with reactivity to human samples 26057-1-AP targets C4orf7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22028 Product name: Recombinant human C4orf7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 18-85 aa of BC062213 Sequence: FPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK Predict reactive species Full Name: chromosome 4 open reading frame 7 Calculated Molecular Weight: 85 aa, 10 kDa Observed Molecular Weight: 8 kDa GenBank Accession Number: BC062213 Gene Symbol: C4orf7 Gene ID (NCBI): 260436 RRID: AB_2880355 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NFU4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.