Product Description
Size: 20ul / 150ul
The UBR1 (26069-1-AP) by Proteintech is a Polyclonal antibody targeting UBR1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples
26069-1-AP targets UBR1 in WB, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: BGC-823 cells, mouse skeletal muscle tissue, rat skeletal muscle tissue
Positive IP detected in: mouse skeletal muscle tissue
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22076 Product name: Recombinant human UBR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC113505 Sequence: MADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQL Predict reactive species
Full Name: ubiquitin protein ligase E3 component n-recognin 1
Calculated Molecular Weight: 1749 aa, 200 kDa
Observed Molecular Weight: 200 kDa
GenBank Accession Number: BC113505
Gene Symbol: UBR1
Gene ID (NCBI): 197131
RRID: AB_2880360
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8IWV7
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924