Iright
BRAND / VENDOR: Proteintech

Proteintech, 26070-1-AP, AGPHD1 Polyclonal antibody

CATALOG NUMBER: 26070-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AGPHD1 (26070-1-AP) by Proteintech is a Polyclonal antibody targeting AGPHD1 in WB, ELISA applications with reactivity to human, mouse samples 26070-1-AP targets AGPHD1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information AGPHD1 encodes the 5-hydroxy-L-lysine kinase which catalyzes the GTP-dependent phosphorylation of 5-hydroxy-L-lysine. It is primarily present in liver and kidneys, suggesting its major role in degrading 5Hyl derived from food. Its presence at lower levels in other tissues indicates that it participates also in the catabolism of 5Hyl derived from local collagen breakdown. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23420 Product name: Recombinant human LOC123688 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC132753 Sequence: MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPTEYVLKISNTKASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKSYLVRLLTYLPGRPIAELPVSPQLLYEIGKLAAKLDKTLQRFHHPKLSSLHRENFIWNLKNVPLLEKYLYALGQNRNREIVEHVIHLFKEEVMTKLSHFRECEYSPN Predict reactive species Full Name: similar to RIKEN cDNA C630028N24 gene Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC132753 Gene Symbol: AGPHD1/HYKK Gene ID (NCBI): 123688 RRID: AB_2880361 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A2RU49 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924