Proteintech, 26103-1-AP, FLJ25006 Polyclonal antibody

Size: 20ul / 150ul The FLJ25006 (26103-1-AP) by Proteintech is a Polyclonal antibody targeting FLJ25006 in WB, ELISA applications with reactivity to mouse samples 26103-1-AP targets FLJ25006 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22017 Product name: Recombinant human FLJ25006 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-171 aa of BC045622 Sequence: MGAVSCRQGQHTQQGEHTRVAVPHKQGGNIRGPWARGWKSLWTGLGTIRSDLEELWELRGHHYLHQESLKPAPVLVEKPLPEWPVPQFINLFLPEFPIRPIRGQQQLKILGLVAKGSFGTVLKVLDCTQKAVFAVKVVPKVKVLQRDTVRQCKEEVSIQVISMTWASCIEM Predict reactive species Full Name: uncharacterized serine/threonine-protein kinase SgK494 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC045622 Gene Symbol: FLJ25006 Gene ID (NCBI): 124923 RRID: AB_2880379 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.