Proteintech, 26105-1-AP, RDX Polyclonal antibody

Size: 20ul / 150ul The RDX (26105-1-AP) by Proteintech is a Polyclonal antibody targeting RDX in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, monkey samples 26105-1-AP targets RDX in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: COS-7 cells, HeLa cells, Jurkat cells, mouse liver tissue, C6 cells, mouse brain tissue, mouse lung tissue, rat brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23532 Product name: Recombinant human RDX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 384-455 aa of BC047109 Sequence: EEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQED Predict reactive species Full Name: radixin Calculated Molecular Weight: 583 aa, 68 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC047109 Gene Symbol: RDX Gene ID (NCBI): 5962 RRID: AB_2880380 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35241 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.