Proteintech, 26151-1-AP, MYEOV2 Polyclonal antibody

Size: 20ul / 150ul The MYEOV2 (26151-1-AP) by Proteintech is a Polyclonal antibody targeting MYEOV2 in WB, ELISA applications with reactivity to human samples 26151-1-AP targets MYEOV2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information MYEOV2, also known as Myeloma-overexpressed gene 2 protein, is a low abundance protein. The function of MYEOV2 remains largely unknown. MYEOV2 has 2 isoforms with MW 27 kDa and 6 kDa according to UniProt. Catalog#26151-1-AP specially recognises the 27 kDa isoform. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23560 Product name: Recombinant human MYEOV2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC033955 Sequence: MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ Predict reactive species Full Name: myeloma overexpressed 2 Observed Molecular Weight: 27 kDa GenBank Accession Number: BC033955 Gene Symbol: MYEOV2 Gene ID (NCBI): 150678 RRID: AB_2880405 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WXC6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.