Proteintech, 26184-1-AP, SLC13A3 Polyclonal antibody

Size: 20ul / 150ul The SLC13A3 (26184-1-AP) by Proteintech is a Polyclonal antibody targeting SLC13A3 in IP, IHC, ELISA applications with reactivity to human, mouse samples 26184-1-AP targets SLC13A3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse kidney tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:4000 Background Information SLC13A3, also named NADC3 and SDCT2, belongs to the SLC13A/DASS transporter (TC 2.A.47) family and NADC subfamily. SLC13A3 encodes the plasma membrane Na+ /Dicarboxylate Cotransporter 3 (NaDC3), which imports inside the cell four to six carbon dicarboxylates as well as N-acetylaspartate (NAA). SLC13A3 is mainly expressed in kidney, but also in brain, liver, placenta and eye (PMID: 30635937). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24182 Product name: Recombinant human SLC13A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 161-229 aa of BC035966 Sequence: SLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRN Predict reactive species Full Name: solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 Calculated Molecular Weight: 602 aa, 67 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC035966 Gene Symbol: SLC13A3 Gene ID (NCBI): 64849 RRID: AB_2868533 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WWT9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.