Iright
BRAND / VENDOR: Proteintech

Proteintech, 26205-1-AP, FAM38B Polyclonal antibody

CATALOG NUMBER: 26205-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM38B (26205-1-AP) by Proteintech is a Polyclonal antibody targeting FAM38B in WB, IHC, ELISA applications with reactivity to human, mouse samples 26205-1-AP targets FAM38B in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HUVEC cells, Neuro-2a cells, SK-N-SH cells Positive IHC detected in: human liver tissue, mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information FAM38B, also named as PIEZO2, is a mechanosensitive, rapidly inactivating (RI) ion channel which is open and converts the mechanical stimulus signals into bioelectrical signals after stimulated by mechanical signals. FAM38B has been recently identified in dorsal root ganglion (DRG) neurons to mediate tactile transduction. It plays an important role in the biological process, maintaining cell metabolism and cell migration. Loss-of-function mutations in the human FAM38B gene cause an autosomal recessive syndrome of muscular atrophy with perinatal respiratory distress, arthrogryposis, and scoliosis.The 80 kDa band detected by SDS-PAGE can be caused by alternative splicing (PMID: 34335288, 37227654). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24528 Product name: Recombinant human FAM38B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 306-401 aa of AB527139 Sequence: KQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSEN Predict reactive species Full Name: family with sequence similarity 38, member B Calculated Molecular Weight: 318 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: AB527139 Gene Symbol: FAM38B Gene ID (NCBI): 63895 RRID: AB_2880425 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H5I5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924