Iright
BRAND / VENDOR: Proteintech

Proteintech, 26207-1-AP, HDAC7 Polyclonal antibody

CATALOG NUMBER: 26207-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HDAC7 (26207-1-AP) by Proteintech is a Polyclonal antibody targeting HDAC7 in IP, ELISA applications with reactivity to human, rat samples 26207-1-AP targets HDAC7 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive IP detected in: K-562 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24396 Product name: Recombinant human HDAC7 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 447-530 aa of BC006453 Sequence: EEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQRLASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL Predict reactive species Full Name: histone deacetylase 7 Calculated Molecular Weight: 103 kDa Observed Molecular Weight: 102 kDa GenBank Accession Number: BC006453 Gene Symbol: HDAC7 Gene ID (NCBI): 51564 RRID: AB_2880426 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WUI4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924