Proteintech, 26226-1-AP, EDEM1 Polyclonal antibody

Size: 20ul / 150ul The EDEM1 (26226-1-AP) by Proteintech is a Polyclonal antibody targeting EDEM1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 26226-1-AP targets EDEM1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells, mouse liver, rat liver Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24046 Product name: Recombinant human EDEM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 564-657 aa of BC019088 Sequence: EDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGLI Predict reactive species Full Name: ER degradation enhancer, mannosidase alpha-like 1 Calculated Molecular Weight: 74 kDa Observed Molecular Weight: 66-75 kDa GenBank Accession Number: BC019088 Gene Symbol: EDEM1 Gene ID (NCBI): 9695 RRID: AB_2880433 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92611 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.