Iright
BRAND / VENDOR: Proteintech

Proteintech, 26234-1-AP, PPAPDC2 Polyclonal antibody

CATALOG NUMBER: 26234-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPAPDC2 (26234-1-AP) by Proteintech is a Polyclonal antibody targeting PPAPDC2 in IF/ICC, IP, ELISA applications with reactivity to human samples 26234-1-AP targets PPAPDC2 in IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HepG2 cells Positive IF/ICC detected in: L02 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23856 Product name: Recombinant human PPAPDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC038108 Sequence: MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATAVDPTCARLRASESPVHRRGSFPLAAAGPSQSPAPP Predict reactive species Full Name: phosphatidic acid phosphatase type 2 domain containing 2 Observed Molecular Weight: 32 kDa GenBank Accession Number: BC038108 Gene Symbol: PPAPDC2 Gene ID (NCBI): 403313 RRID: AB_2880437 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IY26 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924