Proteintech, 26237-1-AP, HAMP Polyclonal antibody

Size: 20ul / 150ul The HAMP (26237-1-AP) by Proteintech is a Polyclonal antibody targeting HAMP in WB, IP, ELISA applications with reactivity to human samples 26237-1-AP targets HAMP in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive IP detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Hepcidin (HAMP) is a liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. It acts by promoting endocytosis and degradation of ferroportin/SLC40A1, leading to the retention of iron in iron-exporting cells and decreased flow of iron into plasma (PMID: 22682227; 29237594; 32814342). Hepcidin is an 84-amino acid prepropeptide, and is usually cleaved into three peptide types, hepcidin-20, hepcidin-22, and hepcidin-25, of which hepcidin-25 is the active form and plays important roles in regulating functional iron deficiency (PMID: 34262329). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24065 Product name: Recombinant human HAMP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-84 aa of BC020612 Sequence: SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT Predict reactive species Full Name: hepcidin antimicrobial peptide Calculated Molecular Weight: 9 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC020612 Gene Symbol: HAMP Gene ID (NCBI): 57817 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P81172 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.