Proteintech, 26244-1-AP, DLX2 Polyclonal antibody

Size: 20ul / 150ul The DLX2 (26244-1-AP) by Proteintech is a Polyclonal antibody targeting DLX2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26244-1-AP targets DLX2 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DLX2, also named as Homeobox protein DLX-2, is a 328 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the distal-less homeobox family. DLX2 localizes in the nucleus and is a Phosphoprotein. DLX2 likely to play a regulatory role in the development of the ventral forebrain and may play a role in craniofacial patterning and morphogenesis. The calcualted molecular weight of DLX2 is 34 kDa, but modified DLX2 is about 45-50 kDa. (PMID: 14769946) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24663 Product name: Recombinant human DLX2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 240-328 aa of BC032558 Sequence: SWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTSGSASHLQATAPLLHPTQTPQPHHHHHHHGGGGAPVSAGTIF Predict reactive species Full Name: distal-less homeobox 2 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC032558 Gene Symbol: DLX2 Gene ID (NCBI): 1746 RRID: AB_2880444 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q07687 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.