Product Description
Size: 20ul / 150ul
The C8orf4 (26279-1-AP) by Proteintech is a Polyclonal antibody targeting C8orf4 in WB, IHC, ELISA applications with reactivity to human, mouse samples
26279-1-AP targets C8orf4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse kidney tissue, HEK-293 cells
Positive IHC detected in: human thyroid cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag23930 Product name: Recombinant human C8orf4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-106 aa of BC021672 Sequence: MKAKRSHQAIIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH Predict reactive species
Full Name: chromosome 8 open reading frame 4
Observed Molecular Weight: 14 kDa
GenBank Accession Number: BC021672
Gene Symbol: C8orf4
Gene ID (NCBI): 56892
RRID: AB_2880460
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NR00
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924