Iright
BRAND / VENDOR: Proteintech

Proteintech, 26284-1-AP, SFR1 Polyclonal antibody

CATALOG NUMBER: 26284-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SFR1 (26284-1-AP) by Proteintech is a Polyclonal antibody targeting SFR1 in WB, ELISA applications with reactivity to human samples 26284-1-AP targets SFR1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The SFR1 protein was initially discovered in the context of DNA homologous recombination repair, and its name originates from "Swi6-interacting recombination repair protein 1." However, subsequent research has revealed its central role in the field of cell death, particularly in the process of **necroptosis**. In the classical necroptosis signaling pathway, when cells receive death signals such as tumor necrosis factor, SFR1 is recruited and phosphorylated by the upstream kinase RIPK3 as a key adaptor protein. Phosphorylated SFR1 specifically binds to and stabilizes MLKL, the core executioner protein of necroptosis, significantly promoting the phosphorylation and subsequent activation of MLKL by RIPK3. This process ultimately leads to plasma membrane rupture and inflammatory cell death. Therefore, SFR1 is considered a critical molecule that precisely regulates the amplification and execution of necroptosis signaling. The study of its function is of great importance for understanding pathological processes such as infections, inflammatory diseases, and tissue damage. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23332 Product name: Recombinant human C10orf78 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-232 aa of BC140835 Sequence: MESPSDSAVVLPSTPQASANPSSPYTNSSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLKNLNVCESQSLDSGSCSALQNEFVSEKLPKQRLNAEKAKLVKQVQEKEDLLRRLKLVKMYRSKNDLSQLQLLIKKWRSCSQLLLYELQSAVSEENKKLSLTQLIDHYGLDDKLLHYNRSEEEFIDV Predict reactive species Full Name: chromosome 10 open reading frame 78 Observed Molecular Weight: 35, 36 kDa GenBank Accession Number: BC140835 Gene Symbol: C10orf78 Gene ID (NCBI): 119392 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86XK3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924