Product Description
Size: 20ul / 150ul
The ZNF641 (26302-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF641 in WB, IF/ICC, ELISA applications with reactivity to human, mouse , rat samples
26302-1-AP targets ZNF641 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse , rat samples.
Tested Applications
Positive WB detected in: mouse skeletal muscle tissue
Positive IF/ICC detected in: A431 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
Zinc finger protein 641(ZNF 641) encodes a zinc-finger protein with five different C2H2 type zinc fingers and a KRAB-A box. Northern blot analysis indicates that ZNF641 is expressed in most of the examined adult tissues, at a high level in skeletal muscle. The ZNF 641 protein contains 438 amino acids and has 4 isoforms (50,43,47,48 kDa) produced by alternative splicing.
Specification
Tested Reactivity: human, mouse , rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag23672 Product name: Recombinant human ZNF641 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC018090 Sequence: MLSEQTAALGTRWESMNVQLDGAEPQVERGSQEERPWRTVPGPLEHLCCDLEEEPQSLQEKAQSAPWVPAIPQEGNTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTD Predict reactive species
Full Name: zinc finger protein 641
Observed Molecular Weight: 40-45 kDa, 50-55 kDa
GenBank Accession Number: BC018090
Gene Symbol: ZNF641
Gene ID (NCBI): 121274
RRID: AB_3085853
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96N77
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924