Iright
BRAND / VENDOR: Proteintech

Proteintech, 26305-1-AP, PDILT Polyclonal antibody

CATALOG NUMBER: 26305-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PDILT (26305-1-AP) by Proteintech is a Polyclonal antibody targeting PDILT in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 26305-1-AP targets PDILT in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information PDILT, a divergent testis-specific protein disulfide isomerase with a non-classical SXXC motif that engages in disulfide-dependent interactions in the endoplasmic reticulum (PMID: 15475357). PDILT interacts with CALR3 in the testicular germ cells and plays an indispensable role in the disulfide formation in the ADAM3. The PDILT knockout mice were male infertile, consistent with the previous observations that spermatozoa lacking ADAM3 cannot migrate through the UTJ and cannot bind to the ZP (PMID: 22357757). It can be detected as 67 kDa and 75kDa due to the glycosylation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23675 Product name: Recombinant human PDILT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 235-584 aa of BC042607 Sequence: KLINDSTNKQELNRVIKQHLTDFVIEYNTENKDLISELHIMSHMLLFVSKSSESYGIIIQHYKLASKEFQNKILFILVDADEPRNGRVFKYFRVTEVDIPSVQILNLSSDARYKMPSDDITYESLKKFGRSFLSKNATKHQSSEEIPKYWDQGLVKQLVGKNFNVVVFDKEKDVFVMFYAPWSKKCKMLFPLLEELGRKYQNHSTIIIAKIDVTANDIQLMYLDRYPFFRLFPSGSQQAVLYKGEHTLKGFSDFLESHIKTKIEDEDELLSVEQNEVIEEEVLAEEKEVPMMRKGLPEQQSPELENMTKYVSKLEEPAGKKKTSEEVVVVVAKPKGPPVQKKKPKVKEEL Predict reactive species Full Name: protein disulfide isomerase-like, testis expressed Observed Molecular Weight: 67 kDa, 75 kDa GenBank Accession Number: BC042607 Gene Symbol: PDILT Gene ID (NCBI): 204474 RRID: AB_2880472 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N807 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924