Proteintech, 26306-1-AP, RNF144B/IBRDC2 Polyclonal antibody

Size: 20ul / 150ul The RNF144B/IBRDC2 (26306-1-AP) by Proteintech is a Polyclonal antibody targeting RNF144B/IBRDC2 in WB, IP, IHC, ELISA applications with reactivity to human samples 26306-1-AP targets RNF144B/IBRDC2 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23679 Product name: Recombinant human RNF144B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 123-187 aa of BC063311 Sequence: VADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAE Predict reactive species Full Name: ring finger protein 144B Observed Molecular Weight: 34 kDa GenBank Accession Number: BC063311 Gene Symbol: RNF144B Gene ID (NCBI): 255488 RRID: AB_2880473 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z419 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.