Iright
BRAND / VENDOR: Proteintech

Proteintech, 26313-1-AP, RFX2 Polyclonal antibody

CATALOG NUMBER: 26313-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RFX2 (26313-1-AP) by Proteintech is a Polyclonal antibody targeting RFX2 in IP, ELISA applications with reactivity to mouse samples 26313-1-AP targets RFX2 in IP, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive IP detected in: mouse testis tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24737 Product name: Recombinant human RFX2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 336-450 aa of BC028579 Sequence: QYIDVSHVFPEFPAPDLGSFLLQDGVTLHDVKALQLVYRRHCEATVDVVMNLQFHYIEKLWLSFWNSKASSSDGPTSLPASDEDPEGAVLPKDKLISLCQCDPILRWMRSCDHIL Predict reactive species Full Name: regulatory factor X, 2 (influences HLA class II expression) Calculated Molecular Weight: 723 aa, 80 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC028579 Gene Symbol: RFX2 Gene ID (NCBI): 5990 RRID: AB_3085855 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48378 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924