Product Description
Size: 20ul / 150ul
The C10orf104 (26324-1-AP) by Proteintech is a Polyclonal antibody targeting C10orf104 in IHC, IF/ICC, IP, ELISA applications with reactivity to human samples
26324-1-AP targets C10orf104 in IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IP detected in: HEK-293 cells
Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: A431 cells
Recommended dilution
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
C10orf104 (also known as ANAPC16 or APC16) is a protein associated with the anaphase-promoting complex/cyclosome (APC/C). APC/C is a highly conserved E3 ubiquitin ligase that regulates various stages of the cell cycle, particularly the transition from mitotic to non-mitotic phases and the entry into the G1 phase during mitosis. As a subunit of APC/C, C10orf104 contributes to its stability and modulates its ubiquitin ligase activity.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag23641 Product name: Recombinant human C10orf104 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC009530 Sequence: MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG Predict reactive species
Full Name: chromosome 10 open reading frame 104
Observed Molecular Weight: 12 kDa
GenBank Accession Number: BC009530
Gene Symbol: C10orf104
Gene ID (NCBI): 119504
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96DE5
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924