Iright
BRAND / VENDOR: Proteintech

Proteintech, 26332-1-AP, AE2 Polyclonal antibody

CATALOG NUMBER: 26332-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AE2 (26332-1-AP) by Proteintech is a Polyclonal antibody targeting AE2 in WB, IHC, ELISA applications with reactivity to human samples 26332-1-AP targets AE2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells Positive IHC detected in: human liver cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information SLC4A2, also named as AE2, encodes a Cl-/HCO3- exchanger. It has been reported that the reduced expression of SLC4A2 found in the liver and peripheral blood mononuclear cells of patients may be associated with the hypermethylation of SLC4A2 promoter regions, which might contribute to the pathogenesis of primary biliary cholangitis (PBC). 26332-1-AP antibody detects 150 kDa and 70 kDa (XP_006716157, 666aa) protein in SDS-PAGE. (PMID: 23341620, 32039364) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23673 Product name: Recombinant human SLC4A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC028601 Sequence: MSSAPRRPAKGADSFCTPEPGRKPRRRPGASPTGETPTIEEGEEDEDEASEAEGARALTQPSPVSTPSSVQFFLQEDDSADRKAERTSPSSPAPLPHQEATPRASKGAQAGTQVEEAEAEAVAVASGTAGGDDGGASGRHLPKAQPGHRSYNLQERRRIGSMTGAEQALL Predict reactive species Full Name: solute carrier family 4, anion exchanger, member 2 (erythrocyte membrane protein band 3-like 1) Calculated Molecular Weight: 1241 aa, 137 kDa Observed Molecular Weight: 150 and 70 kDa GenBank Accession Number: BC028601 Gene Symbol: AE2 Gene ID (NCBI): 6522 RRID: AB_2880481 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04920 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924