Iright
BRAND / VENDOR: Proteintech

Proteintech, 26342-1-AP, Draxin Polyclonal antibody

CATALOG NUMBER: 26342-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Draxin (26342-1-AP) by Proteintech is a Polyclonal antibody targeting Draxin in WB, ELISA applications with reactivity to human, mouse, rat samples 26342-1-AP targets Draxin in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse cerebellum tissue, SH-SY5Y cells, rat cerebellum tissue, rat cerebellm tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information C1orf187, also named Draxin(Dorsal repulsive axon guidance protein), is a repulsive axon guidance cue. It is widely expressed in the developing hippocampus, glioma, and all histological types of the lung cancer cell. Draxin was shown to bind a 22-amino-acid peptide of the EGF domain of Netrin-1, and through Draxin/Netrin-1 interaction, Draxin may act as a secreted Netrin-1 antagonist. C1orf187 can inhibit or repel neurite outgrowth from dorsal spinal cord. It inhibits the stabilization of cytosolic beta-catenin (CTNNB1) via its interaction with LRP6, thereby acting as an antagonist of Wnt signaling pathway (PMID: 29622850). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23666 Product name: Recombinant human C1orf187 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 171-349 aa of BC021286 Sequence: QVLDAAMEESSTSLAPTMFFLTTFEAAPATEESLILPVTSLRPQQAQPRSDGEVMPTLDMALFDWTDYEDLKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDHHQDCLPGTCCDLREHLCTPHNRGLNNKCFDDCMCVEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFINV Predict reactive species Full Name: chromosome 1 open reading frame 187 Observed Molecular Weight: 32 kDa GenBank Accession Number: BC021286 Gene Symbol: C1orf187 Gene ID (NCBI): 374946 RRID: AB_2880483 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NBI3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924