Iright
BRAND / VENDOR: Proteintech

Proteintech, 26351-1-AP, Neurofascin Polyclonal antibody

CATALOG NUMBER: 26351-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Neurofascin (26351-1-AP) by Proteintech is a Polyclonal antibody targeting Neurofascin in WB, IHC, ELISA applications with reactivity to human, rat, mouse samples 26351-1-AP targets Neurofascin in WB, IHC, ELISA applications and shows reactivity with human, rat, mouse samples. Tested Applications Positive WB detected in: rat brain tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, rat, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24165 Product name: Recombinant human NFASC protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 74-185 aa of BC137013 Sequence: RFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQ Predict reactive species Full Name: neurofascin homolog (chicken) Calculated Molecular Weight: 1347 aa, 150 kDa Observed Molecular Weight: 186 kDa GenBank Accession Number: BC137013 Gene Symbol: Neurofascin Gene ID (NCBI): 23114 RRID: AB_2880486 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94856 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924