Product Description
Size: 20ul / 150ul
The Neurofascin (26351-1-AP) by Proteintech is a Polyclonal antibody targeting Neurofascin in WB, IHC, ELISA applications with reactivity to human, rat, mouse samples
26351-1-AP targets Neurofascin in WB, IHC, ELISA applications and shows reactivity with human, rat, mouse samples.
Tested Applications
Positive WB detected in: rat brain tissue
Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Specification
Tested Reactivity: human, rat, mouse
Cited Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24165 Product name: Recombinant human NFASC protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 74-185 aa of BC137013 Sequence: RFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQ Predict reactive species
Full Name: neurofascin homolog (chicken)
Calculated Molecular Weight: 1347 aa, 150 kDa
Observed Molecular Weight: 186 kDa
GenBank Accession Number: BC137013
Gene Symbol: Neurofascin
Gene ID (NCBI): 23114
RRID: AB_2880486
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O94856
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924