Proteintech, 26366-1-AP, PAR1/Thrombin Receptor Polyclonal antibody

Size: 20ul / 150ul The PAR1/Thrombin Receptor (26366-1-AP) by Proteintech is a Polyclonal antibody targeting PAR1/Thrombin Receptor in WB, IHC, ELISA applications with reactivity to human, mouse samples 26366-1-AP targets PAR1/Thrombin Receptor in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Y79 cells, K-562 cells, mouse liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Protease-activated receptor-1 (PAR1) is a G protein coupled receptor.PAR1 has a greater affinity for thrombin and mediates rapid Ca2+ mobilization and platelet activation. PAR1 has a calculated molecular weight of 47 kDa, but can be detected as 70 kDa after posttranslational modification.(PMID: 26822533) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, monkey, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24378 Product name: Recombinant human F2R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 44-102 aa of BC051909 Sequence: LLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT Predict reactive species Full Name: coagulation factor II (thrombin) receptor Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 70 kDa, 47 kDa GenBank Accession Number: BC051909 Gene Symbol: F2R Gene ID (NCBI): 2149 RRID: AB_2880492 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25116 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.