Iright
BRAND / VENDOR: Proteintech

Proteintech, 26385-1-AP, DDX5 Polyclonal antibody

CATALOG NUMBER: 26385-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DDX5 (26385-1-AP) by Proteintech is a Polyclonal antibody targeting DDX5 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, rat, mouse samples 26385-1-AP targets DDX5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse liver tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DDX5 or p68, a member of DEAD/H BOX, which has a characteristic DEAD box, is a proliferation-associated nuclear antigen. DDX5 involves in the alternative regulation of pre-mRNA splicing, act as a RNA helicase to increase tau exon10 inclusion in a RBM4-dependent manner. It's also a transcription coactivator for extrogen receptor ESR1 and androgen receptor AR. Once synergized with DDX17 and SRA1 RNA, DDX5 activated MYOD1 transcription activity and involved in skeletal muscle differentiation. Specification Tested Reactivity: human, rat, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24821 Product name: Recombinant human DDX5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 434-614 aa of NM_004396 Sequence: RSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 Observed Molecular Weight: 69 kDa GenBank Accession Number: NM_004396 Gene Symbol: DDX5 Gene ID (NCBI): 1655 RRID: AB_2880498 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17844 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924