Iright
BRAND / VENDOR: Proteintech

Proteintech, 26403-1-AP, SLC7A7 Polyclonal antibody

CATALOG NUMBER: 26403-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC7A7 (26403-1-AP) by Proteintech is a Polyclonal antibody targeting SLC7A7 in WB, ELISA applications with reactivity to human, mouse, rat samples 26403-1-AP targets SLC7A7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse kidney tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23872 Product name: Recombinant human SLC7A7 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 459-511 aa of BC010107 Sequence: LIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN Predict reactive species Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 Calculated Molecular Weight: 511 aa, 56 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC010107 Gene Symbol: SLC7A7 Gene ID (NCBI): 9056 RRID: AB_3669533 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UM01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924