Iright
BRAND / VENDOR: Proteintech

Proteintech, 26407-1-AP, SLC5A6 Polyclonal antibody

CATALOG NUMBER: 26407-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC5A6 (26407-1-AP) by Proteintech is a Polyclonal antibody targeting SLC5A6 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 26407-1-AP targets SLC5A6 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Caco-2 cells, mouse brain tissue, mouse small intestine tissue, COLO 320 cells, rat brain tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information SLC5A6, also known as the sodium-dependent multivitamin transporter (hSMVT), is a transmembrane protein that plays a crucial role in the uptake of essential vitamins, including biotin, pantothenic acid, and lipoic acid. This protein is widely expressed in various human tissues, including the placenta, intestine, brain, liver, lung, kidney, cornea, retina, and heart. It uses energy from the transmembrane sodium ion gradient and membrane potential to actively transport these vitamins into cells. Due to different glycosylation modifications, SLC5A6 may exhibit two bands at ~55 kDa and ~69 kDa. (PMID: 20980265, PMID: 25971966) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23907 Product name: Recombinant human SLC5A6 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 551-635 aa of BC012806 Sequence: RMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL Predict reactive species Full Name: solute carrier family 5 (sodium-dependent vitamin transporter), member 6 Observed Molecular Weight: 69 kDa GenBank Accession Number: BC012806 Gene Symbol: SLC5A6 Gene ID (NCBI): 8884 RRID: AB_2880502 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y289 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924