Iright
BRAND / VENDOR: Proteintech

Proteintech, 26422-1-AP, HIF2α/EPAS1 Polyclonal antibody

CATALOG NUMBER: 26422-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HIF2α/EPAS1 (26422-1-AP) by Proteintech is a Polyclonal antibody targeting HIF2α/EPAS1 in WB, ELISA applications with reactivity to human samples 26422-1-AP targets HIF2α/EPAS1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Cobalt Chloride treated HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information HIF2A, also named as EPAS1, is a 870 amino acid protein, which is expressed in most tissues, with highest levels in placenta, lung and heart. HIF2A colocalizes with HIF3A in the nucleus and speckles. HIF2A as a transcription factor involves in the induction of oxygen regulated genes. HIF2A binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. HIF2A regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. HIF2A may also play a role in the formation of the endothelium that gives rise to the blood brain barrier. The calculated molecular weight of HIF2A is 96 kDa, but In normoxia, HIF2A is probably hydroxylated on Pro-405 and Pro-531 by EGLN1/PHD1, EGLN2/PHD2 and/or EGLN3/PHD3. The hydroxylated prolines promote interaction with VHL, initiating rapid ubiquitination and subsequent proteasomal degradation. Under hypoxia, proline hydroxylation is impaired and ubiquitination is attenuated, resulting in stabilization. The modified HIf2A is about 100-120 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24886 Product name: Recombinant human EPAS1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 521-870 aa of BC051338 Sequence: FNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT Predict reactive species Full Name: endothelial PAS domain protein 1 Calculated Molecular Weight: 96 kDa Observed Molecular Weight: 100-120 kDa GenBank Accession Number: BC051338 Gene Symbol: HIF2α Gene ID (NCBI): 2034 RRID: AB_2880510 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99814 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924