Iright
BRAND / VENDOR: Proteintech

Proteintech, 26451-1-AP, TMEM160 Polyclonal antibody

CATALOG NUMBER: 26451-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM160 (26451-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM160 in WB, IHC, ELISA applications with reactivity to human samples 26451-1-AP targets TMEM160 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The transmembrane protein (TMEM) family encompasses transmembrane proteins that traverse the lipid bilayer and wield critical functions across various cell types, encompassing inflammation and store-operated Ca2+ entry. TMEM160, a identified transmembrane protein that is localized in the mitochondrial membrane, has been implicated in neuropathic pain. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24915 Product name: Recombinant human TMEM160 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC002907 Sequence: MGGGWWWARAARLARLRFRRSLLPPQRPRSGGARGSFAPGHGPRAGASPPPVSELDRADAWLLRKAHE Predict reactive species Full Name: transmembrane protein 160 Calculated Molecular Weight: 188 aa, 20 kDa Observed Molecular Weight: 15-20 kDa GenBank Accession Number: BC002907 Gene Symbol: TMEM160 Gene ID (NCBI): 54958 RRID: AB_3669535 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NX00 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924