Iright
BRAND / VENDOR: Proteintech

Proteintech, 26460-1-AP, SFRP1 Polyclonal antibody

CATALOG NUMBER: 26460-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SFRP1 (26460-1-AP) by Proteintech is a Polyclonal antibody targeting SFRP1 in WB, IHC, IF/ICC, IF-Fro, ELISA applications with reactivity to human, mouse samples 26460-1-AP targets SFRP1 in WB, IHC, IF/ICC, IF-Fro, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, NIH/3T3 cells, mouse kidney tissue, rat kidney tissue, SH-SY5Y cells, U2OS cells, mouse testis tissue Positive IHC detected in: human breast cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-Fro detected in: mouse brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24844 Product name: Recombinant human SFRP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 164-250 aa of BC036503 Sequence: DVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYL Predict reactive species Full Name: secreted frizzled-related protein 1 Calculated Molecular Weight: 314 aa, 35 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC036503 Gene Symbol: SFRP1 Gene ID (NCBI): 6422 RRID: AB_2880522 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N474 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924