Iright
BRAND / VENDOR: Proteintech

Proteintech, 26473-1-AP, PTCD2 Polyclonal antibody

CATALOG NUMBER: 26473-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PTCD2 (26473-1-AP) by Proteintech is a Polyclonal antibody targeting PTCD2 in WB, ELISA applications with reactivity to human samples 26473-1-AP targets PTCD2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PTCD2 (Pentatricopeptide repeat-containing protein 2), a mysterious protein whose function was unknown despite the available data. Its mitochondrial localization and PPR family membership suggested its possible biological role in regulation of mitochondrial gene expression. (PMID: 36430722) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24115 Product name: Recombinant human PTCD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC018720 Sequence: MKDQHLRGFFSDSTSFNILMDMLFIKGKYKSALQVLIEMKNQDVKFTKDTYVLAFAICYKLNSPESFKICTTLREEALLKGEILSRRASCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIHIQSNMLENLIKTLKNAAEGNLSKFVKRHVFSEEVLAKVREKVKDVPALVAKFDEIYGTLHITGQVTTDSLDAVLCHTPRDRKSHTLLLNKRMVSRRTFQPLSQSLLAE Predict reactive species Full Name: pentatricopeptide repeat domain 2 Observed Molecular Weight: 33 kDa GenBank Accession Number: BC018720 Gene Symbol: PTCD2 Gene ID (NCBI): 79810 RRID: AB_3669538 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WV60 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924