Proteintech, 26486-1-AP, SLC2A9 Polyclonal antibody

Size: 20ul / 150ul The SLC2A9 (26486-1-AP) by Proteintech is a Polyclonal antibody targeting SLC2A9 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26486-1-AP targets SLC2A9 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IHC detected in: human liver tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24135 Product name: Recombinant human SLC2A9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 443-511 aa of BC018897 Sequence: IQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP Predict reactive species Full Name: solute carrier family 2 (facilitated glucose transporter), member 9 Calculated Molecular Weight: 540 aa, 59 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC018897 Gene Symbol: SLC2A9 Gene ID (NCBI): 56606 RRID: AB_2880532 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRM0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.