Iright
BRAND / VENDOR: Proteintech

Proteintech, 26495-1-AP, EGR3 Polyclonal antibody

CATALOG NUMBER: 26495-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EGR3 (26495-1-AP) by Proteintech is a Polyclonal antibody targeting EGR3 in WB, ELISA applications with reactivity to human samples 26495-1-AP targets EGR3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The early growth response (Egr) family of zinc finger transcription factors regulates critical genetic programs in cellular growth, differentiation, and function. EGR3 (Early Growth Response 3; also known as PILOT) is a member of the early growth response (Egr) gene family of transcription factors. EGR3 regulates the expression of genes involved in inflammation, including genes encoding various secreted cytokines and protease inhibitors. EGR3 functions as a master regulator of genes differentially expressed in the brains of patients with neuropsychiatric illnesses ranging from schizophrenia and bipolar disorder to Alzheimer's disease. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24152 Product name: Recombinant human EGR3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-186 aa of BC104765 Sequence: MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSN Predict reactive species Full Name: early growth response 3 Calculated Molecular Weight: 387 aa, 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC104765 Gene Symbol: EGR3 Gene ID (NCBI): 1960 RRID: AB_3669540 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q06889 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924