Iright
BRAND / VENDOR: Proteintech

Proteintech, 26509-1-AP, FAM181A Polyclonal antibody

CATALOG NUMBER: 26509-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM181A (26509-1-AP) by Proteintech is a Polyclonal antibody targeting FAM181A in IHC, ELISA applications with reactivity to human, mouse samples 26509-1-AP targets FAM181A in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Family with sequence similarity 181 (FAM181) a gene family that contains two members FAM181A and FAM181B in vertebrates. FAM181A is predominant expression in human and mouse testes. Knockout of the Fam181a gene in mice does not impair spermatogenesis or male fertility (PMID: 34253288). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24150 Product name: Recombinant human FAM181A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 45-292 aa of BC009073 Sequence: LKRFSQKYSRLPRGLPGRAAEPYLKRGSEDRPRRLLLDLGPDSSPGGGGGCKEKVLRNPYREECLAKEQLPQRQHPEAAQPGQVPMRKRQLPASFWEEPRPTHSYHVGLEGGLGPREGPPYEGKKNCKGLEPLGPETTLVSMSPRALAEKEPLKMPGVSLVGRVNAWSCCPFQYHGQPIYPGPLGALPQSPVPSLGLWRKSPAFPGELAHLCKDVDGLGQKVCRPVVLKPIPTKPAVPPPIFNVFGYL Predict reactive species Full Name: family with sequence similarity 181, member A GenBank Accession Number: BC009073 Gene Symbol: FAM181A Gene ID (NCBI): 90050 RRID: AB_3669544 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N9Y4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924