Iright
BRAND / VENDOR: Proteintech

Proteintech, 26513-1-AP, DIO2 Polyclonal antibody

CATALOG NUMBER: 26513-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DIO2 (26513-1-AP) by Proteintech is a Polyclonal antibody targeting DIO2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 26513-1-AP targets DIO2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, MCF-7 cells Positive IHC detected in: human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Type II iodothyronine deiodinase(DIO2), belongs to the iodothyronine deiodinase family, with two isoform of 30 and 34 kDa. DIO2 can activates thyroid hormone by converting the prohormone thyroxine (T4) by outer ring deiodination (ORD) to bioactive 3,3',5-triiodothyronine (T3). DIO2 is thought to be responsible for the 'local' production of T3, and thus important in influencing thyroid hormone action in these tissues. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24119 Product name: Recombinant human DIO2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 171-273 aa of BC074882 Sequence: AIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG Predict reactive species Full Name: deiodinase, iodothyronine, type II Calculated Molecular Weight: 273 aa, 31 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC074882 Gene Symbol: DIO2 Gene ID (NCBI): 1734 RRID: AB_2880538 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92813 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924