Proteintech, 26532-1-AP, PPM1D Polyclonal antibody

Size: 20ul / 150ul The PPM1D (26532-1-AP) by Proteintech is a Polyclonal antibody targeting PPM1D in WB, IF/ICC, ELISA applications with reactivity to human, mouse, Rat samples 26532-1-AP targets PPM1D in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, Rat samples. Tested Applications Positive WB detected in: MCF-7 cells, mouse lung tissue, rat testis tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PPM1D (also known as PP2Cd and WIP1) is a member of the PPM family, which is characterized by Mg2+/Mn2+-dependent activity and relative insensitivity to okadaic acid. The PPM1D gene is aberrantly amplified in a range of common cancers and encodes a protein phosphatase that is a potential therapeutic target (PMID: 17700519). This antibody can be detected two bands of 47 and 67 Kda. Specification Tested Reactivity: human, mouse, Rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24751 Product name: Recombinant human PPM1D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 254-423 aa of BC060877 Sequence: NGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPQQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVKSLE Predict reactive species Full Name: protein phosphatase 1D magnesium-dependent, delta isoform Observed Molecular Weight: 67 kDa GenBank Accession Number: BC060877 Gene Symbol: PPM1D Gene ID (NCBI): 8493 RRID: AB_2880544 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15297 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.