Proteintech, 26550-1-AP, 53BP2 Polyclonal antibody

Size: 20ul / 150ul The 53BP2 (26550-1-AP) by Proteintech is a Polyclonal antibody targeting 53BP2 in WB, ELISA applications with reactivity to human samples 26550-1-AP targets 53BP2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, MCF-7 cells, Jurkat cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24907 Product name: Recombinant human TP53BP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 273-519 aa of BC040247 Sequence: SSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFR Predict reactive species Full Name: tumor protein p53 binding protein, 2 Observed Molecular Weight: 150 kDa GenBank Accession Number: BC040247 Gene Symbol: TP53BP2 Gene ID (NCBI): 7159 RRID: AB_2880549 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13625 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.