Iright
BRAND / VENDOR: Proteintech

Proteintech, 26572-1-AP, PRRT3 Polyclonal antibody

CATALOG NUMBER: 26572-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRRT3 (26572-1-AP) by Proteintech is a Polyclonal antibody targeting PRRT3 in WB, ELISA applications with reactivity to human, mouse, rat samples 26572-1-AP targets PRRT3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C6 cells, mouse brain tissue, mouse colon tissue, rat brain tissue, rat colon tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information PRRT3 is a proline-rich, single-pass transmembrane protein enriched in the nervous system, where it likely functions as a membrane-associated adaptor supporting protein-protein interactions involved in neuronal signaling or vesicle dynamics. Although its precise biological role remains incompletely defined, PRRT3 shares structural features with PRRT family members implicated in synaptic regulation, suggesting a contributory role in neuronal network stability and signaling organization. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23627 Product name: Recombinant human PRRT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 323-597 aa of BC040508 Sequence: TEHACWAKLMRLACPAPSGKSEVPERPNNCYAGPSNVGAGSLDISKSLIRNPAESGQLATPSSGAWGSAASLGRGPQGGPGLSRNGVGPAPSLSELDLRPPSPINLSRSIDATLFREHLVRDSVFQRCGLRGLASPPPGGALRPRRGSHPKAELDDAGSSLLRGRCRSLSDVRVRGPVPQHVVEAPDGAAAAASGSSLDSFSRGSLKISWNPWRHGLSSVDSLPLDELPSTVQLLPAPTPAPDSTAARQGDGQGEVQPRGKPGESRSASSDTIEL Predict reactive species Full Name: proline-rich transmembrane protein 3 Observed Molecular Weight: 65 kDa GenBank Accession Number: BC040508 Gene Symbol: PRRT3 Gene ID (NCBI): 285368 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5FWE3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924