Product Description
Size: 20ul / 150ul
The CD55 (26580-1-AP) by Proteintech is a Polyclonal antibody targeting CD55 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
26580-1-AP targets CD55 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A549 cells, HeLa cells, MKN-45 cells, human placenta tissue
Positive IHC detected in: human placenta tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: A549 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:4000-1:16000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
CD55, also known as DAF, is a glycosylphosphatidylinositol (GPI)-anchored surface glycoprotein that is widely distributed on blood, stroma, epithelial, and endothelial cells (PMID: 7517044; 29503741). It can also exist as a soluble form in plasma, urine, saliva, tears, and synovial fluids (PMID: 29503741). CD55 is a complement regulatory protein (PMID: 2469439; 7517044). It inhibits formation of the C3 convertases through binding to C3b and C4b. It also binds the alternate pathway convertase C3bBb, the classical pathway convertase and C4b2a to accelerate their decay (PMID: 17289551). CD55 also serves as a receptor for coxsackieviruses B1, B3, and B5 and several enteroviruses (PMID: 7538177; 7517044). The observed molecular weight of mature CD55 varies between 50 to 100 kDa depending on the cell type. Different sizes of CD55 might be caused by alternative splicing or different glycosylation patterns (PMID: 29503741).
Specification
Tested Reactivity: human
Cited Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25026 Product name: Recombinant human CD55 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-126 aa of BC001288 Sequence: DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE Predict reactive species
Full Name: CD55 molecule, decay accelerating factor for complement (Cromer blood group)
Calculated Molecular Weight: 41 kDa
Observed Molecular Weight: 60-80 kDa
GenBank Accession Number: BC001288
Gene Symbol: CD55
Gene ID (NCBI): 1604
RRID: AB_2880559
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P08174
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924