Iright
BRAND / VENDOR: Proteintech

Proteintech, 26600-1-AP, STK17B Polyclonal antibody

CATALOG NUMBER: 26600-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STK17B (26600-1-AP) by Proteintech is a Polyclonal antibody targeting STK17B in WB, IHC, ELISA applications with reactivity to human samples 26600-1-AP targets STK17B in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, HepG2 cells, K-562 cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information Serine/threonine kinase 17B (STK17B), also named as DRAK2, whose gene is located on chromosome 2 (2q32.3), was first reported by Sanjo et al. in 1998 (PMID: 9786912). STK17B has been identified as a promising therapeutic target for type 1 diabetes, multiple sclerosis, and graft rejection. There are also some reports demonstrated that STK17B was related to apoptosis in various cell types, such as islet β-cells and acute myeloid leukemia cells. Some researches revealed that STK17B was deregulated in some cancers and have important role in cancer progression (PMID: 29445189). It has an indispensable role in NAFLD/NASH and offer a potential therapeutic arget for this disease (PMID: 34614409). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24389 Product name: Recombinant human STK17B protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 250-372 aa of BC016040 Sequence: VNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSLPNPHELVSDLLC Predict reactive species Full Name: serine/threonine kinase 17b Calculated Molecular Weight: 372 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC016040 Gene Symbol: STK17B Gene ID (NCBI): 9262 RRID: AB_2880570 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94768 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924