Iright
BRAND / VENDOR: Proteintech

Proteintech, 26601-1-AP, SLC40A1/FPN1 Polyclonal antibody

CATALOG NUMBER: 26601-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC40A1/FPN1 (26601-1-AP) by Proteintech is a Polyclonal antibody targeting SLC40A1/FPN1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26601-1-AP targets SLC40A1/FPN1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Caco-2 cells, mouse spleen tissue, HepG2 cells, mouse liver tissue, rat spleen, HEK-293T cells, SW480 cells Positive IHC detected in: human liver tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC40A1, also named as Ferroportin 1 (FPN1), is an iron transporter which is involved in iron export from duodenal epithelial cell and also in transfer of iron between maternal and fetal circulation. It has been reported that SLC40A1 mutations may lead to macrophage iron overload, hyperferritinemia, and normal transferrin saturation among ferroportin iron overload patients. This antibody detects 50-75 kDa protein as well as the fragments of 56 kDa and 35 kDa protein similar to papers in SDS-PAGE (PMID:32645092, 21396368,16054062, 18974313). SLC40A1 is mainly localized to the cell membrane, but may also be detected in the cytoplasm. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, chicken, zebrafish, bovine, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24273 Product name: Recombinant human SLC40A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 398-500 aa of BC037733 Sequence: LDLSVSPFEDIRSRFIQGESITPTKIPEITTEIYMSNGSNSANIVPETSPESVPIISVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMN Predict reactive species Full Name: solute carrier family 40 (iron-regulated transporter), member 1 Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 62-70 kDa GenBank Accession Number: BC037733 Gene Symbol: SLC40A1/Ferroportin Gene ID (NCBI): 30061 RRID: AB_2880571 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NP59 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924