Iright
BRAND / VENDOR: Proteintech

Proteintech, 26602-1-AP, GJA5/Connexin 40 Polyclonal antibody

CATALOG NUMBER: 26602-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GJA5/Connexin 40 (26602-1-AP) by Proteintech is a Polyclonal antibody targeting GJA5/Connexin 40 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 26602-1-AP targets GJA5/Connexin 40 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse lung tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Connexin 40 (Cx40), also known as Gap junction alpha 5 protein (GJA5), belongs to the connexin family. Connexins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. Four connexins (Cxs) are expressed in the cardiovascular system (Cx37, Cx40, Cx43, and Cx45) and are involved in the development of the cardiovascular system(PMID: 37331352; PMID: 17922338). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24266 Product name: Recombinant human GJA5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 233-341 aa of BC013313 Sequence: KIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDK Predict reactive species Full Name: gap junction protein, alpha 5, 40kDa Calculated Molecular Weight: 40 kDa GenBank Accession Number: BC013313 Gene Symbol: GJA5 Gene ID (NCBI): 2702 RRID: AB_3669552 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36382 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924