Proteintech, 26608-1-AP, LOXL1 Polyclonal antibody

Size: 20ul / 150ul The LOXL1 (26608-1-AP) by Proteintech is a Polyclonal antibody targeting LOXL1 in WB, ELISA applications with reactivity to human samples 26608-1-AP targets LOXL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Three LOXL1 variants are seen: a band of 64 kDa matching the predicted full-length form lacking the secretory signal peptide, a band of 67 kDa presumed to be the full-length form with the signal peptide, and a band of 36 kDa matching the cleavage product. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24293 Product name: Recombinant human LOXL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 283-366 aa of BC015090 Sequence: TPGFEQAYPDPGPEAAQAHGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQQGRLSVGSVYRPNQNG Predict reactive species Full Name: lysyl oxidase-like 1 Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 63-70 kDa GenBank Accession Number: BC015090 Gene Symbol: LOXL1 Gene ID (NCBI): 4016 RRID: AB_2880573 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q08397 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.