Iright
BRAND / VENDOR: Proteintech

Proteintech, 26611-1-AP, SLC26A1 Polyclonal antibody

CATALOG NUMBER: 26611-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC26A1 (26611-1-AP) by Proteintech is a Polyclonal antibody targeting SLC26A1 in WB, IP, ELISA applications with reactivity to human, mouse samples 26611-1-AP targets SLC26A1 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse spleen tissue Positive IP detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24306 Product name: Recombinant human SLC26A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-70 aa of BC015517 Sequence: MDESPEPLQQGRGPVPVRRQRPAPRGLREMLKARLWCSCSCSVLCVRALVQDLLPATRWLRQYRPREYLA Predict reactive species Full Name: solute carrier family 26 (sulfate transporter), member 1 Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 70 kDa~85 kDa GenBank Accession Number: BC015517 Gene Symbol: SLC26A1 Gene ID (NCBI): 10861 RRID: AB_2880574 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H2B4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924