Product Description
Size: 20ul / 150ul
The ALDH9A1 (26621-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH9A1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples
26621-1-AP targets ALDH9A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: NIH/3T3 cells, HEK-293 cells
Positive IHC detected in: human liver cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:100-1:400
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
Aldehyde dehydrogenase 9 family member A1(ALDH9A1), belongs to the aldehyde dehydrogenase family of proteins. ALDH9A1 has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. ALDH9A1 catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid. ALDH9A1 has 3 isoforms with the molecular mass of 46-56 kDa.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24312 Product name: Recombinant human ALDH9A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 285-412 aa of BC151140 Sequence: LIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCV Predict reactive species
Full Name: aldehyde dehydrogenase 9 family, member A1
Calculated Molecular Weight: 518 aa, 56 kDa
Observed Molecular Weight: 46 kDa
GenBank Accession Number: BC151140
Gene Symbol: ALDH9A1
Gene ID (NCBI): 223
RRID: AB_2880577
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P49189
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924