Iright
BRAND / VENDOR: Proteintech

Proteintech, 26646-1-AP, MBOAT7 Polyclonal antibody

CATALOG NUMBER: 26646-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MBOAT7 (26646-1-AP) by Proteintech is a Polyclonal antibody targeting MBOAT7 in WB, ELISA applications with reactivity to human, mouse samples 26646-1-AP targets MBOAT7 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information MBOAT7 (membrane-bound O-acyltransferase domain containing 7), also known as LPIAT, LENG4, or BB1, belongs to the MBOAT superfamily. MBOAT7 acylates lyso-phosphatidylinositol (lyso-PI) with arachidonyl-CoA and is involved in phosphatidylinositol acyl-chain remodeling in the Lands cycle (PMID: 30959108; PMID: 35509994). MBOAT7 deficiency in humans leads to developmental disorders of the central nervous system, with intellectual disability, epilepsy, and autism spectrum disorder (PMID: 37316513). This antibody ditects all the isoforms of MBOA7 with MW 53 kDa, 40-44 kDa and 38 kDa. With modifications, the MW is even higher. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24490 Product name: Recombinant human MBOAT7 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 284-344 aa of BC006309 Sequence: SSPEKAASLEYDYETIRNIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLR Predict reactive species Full Name: membrane bound O-acyltransferase domain containing 7 Calculated Molecular Weight: 472 aa, 53 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC006309 Gene Symbol: MBOAT7 Gene ID (NCBI): 79143 RRID: AB_3085890 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96N66 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924