Iright
BRAND / VENDOR: Proteintech

Proteintech, 26674-1-AP, CACNA2D4 Polyclonal antibody

CATALOG NUMBER: 26674-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CACNA2D4 (26674-1-AP) by Proteintech is a Polyclonal antibody targeting CACNA2D4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26674-1-AP targets CACNA2D4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Calcium voltage-gated channel auxiliary subunit alpha2delta 4 (CACNA2D4, also known as RCD4) is a member of the alpha-2/delta subunit family within the voltage-dependent calcium channel complex. The α2δ4 subunit of retinal voltage-gated calcium channels (Cav), is crucial for developing and mature exocytotic function of the photoreceptor ribbon synapse (PMID: 29875267). CACNA2D4 is localized to the retina, particularly in photoreceptors, where it is essential for organizing synaptic ribbons and setting Cav1.4 voltage sensitivity (PMID: 28262416). In humans, mutations in CACNA2D4 are associated with autosomal recessive cone dystrophy, a condition that affects the photoreceptor cells in the retina (PMID: 16877424). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24464 Product name: Recombinant human CACNA2D4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 532-601 aa of BC150186 Sequence: GSDVALRELMKLAPRYKMPSTNSRPNAPPPWTLAAWSARIRLSEHQQWLHPLPSRPPAPVQRGEETKTQT Predict reactive species Full Name: calcium channel, voltage-dependent, alpha 2/delta subunit 4 Calculated Molecular Weight: 1137 aa, 128 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC150186 Gene Symbol: CACNA2D4 Gene ID (NCBI): 93589 RRID: AB_3669562 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z3S7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924