Iright
BRAND / VENDOR: Proteintech

Proteintech, 26696-1-AP, BMPR1B Polyclonal antibody

CATALOG NUMBER: 26696-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BMPR1B (26696-1-AP) by Proteintech is a Polyclonal antibody targeting BMPR1B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 26696-1-AP targets BMPR1B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, rat colon tissue Positive IHC detected in: rat ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information BMPR1B (Bone morphogenetic protein receptor type-1B) is also named as CDw293. BMPR1B belongs to the protein kinase superfamily. BMPR1B is on ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. BMPR1B is receptor for BMP7/OP-1 and GDF5. BMPR1B Positively regulates chondrocyte differentiation through GDF5 interaction. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24902 Product name: Recombinant human BMPR1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-57 aa of BC047773 Sequence: EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI Predict reactive species Full Name: bone morphogenetic protein receptor, type IB Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC047773 Gene Symbol: BMPR1B Gene ID (NCBI): 658 RRID: AB_3085892 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00238 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924