Proteintech, 26701-1-AP, WDR35 Polyclonal antibody

Size: 20ul / 150ul The WDR35 (26701-1-AP) by Proteintech is a Polyclonal antibody targeting WDR35 in IF/ICC, ELISA applications with reactivity to human, canine samples 26701-1-AP targets WDR35 in IF/ICC, ELISA applications and shows reactivity with human, canine samples. Tested Applications Positive IF/ICC detected in: MDCK cells, hTERT-RPE1 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information WDR35, a component of the IFT complex A (IFT-A), is required for retrograde ciliary transport and entry into cilia of G protein-coupled receptors (GPCRs). It is involved in ciliogenesis and ciliary protein trafficking (PMID:21473986, PMID:28400947, PMID:29220510). It may promote CASP3 activation and TNF-stimulated apoptosis (PMID: 20193664). Specification Tested Reactivity: human, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24965 Product name: Recombinant human WDR35 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 822-1170 aa of BC036659 Sequence: AECYYMLEDYEGLENLAISLPENHKLLPEIAQMFVRVGMCEQAVTTFLKCSQPKAAVDTCVHLNQWNKAVELAKNHSMKEIGSLLARYASHLLEKNKTLDAIELYRKANYFFDAAKLMFKIADEEAKKGSKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKGKSSEATSALAGLLEEEVLSTTDRFTDNAWRGAEAYHFFILAQRQLYEGCVDTALKTALHLKDYEDIIPPVEIYSLLALCACAGRAFGTCSKAFIKLKSLETLSSEQKQQYEDLALEIFTKHTSKDNRKPELDSLMEGGEGKLPTCVATGSPITEYQFWMCSVCKHGVLAQEISHYSFCPLCHSPVG Predict reactive species Full Name: WD repeat domain 35 Calculated Molecular Weight: 1170 aa, 132 kDa GenBank Accession Number: BC036659 Gene Symbol: WDR35 Gene ID (NCBI): 57539 RRID: AB_3085893 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P2L0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.